SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1

BUY SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha; Short Neurotoxin 1

Short Neurotoxin alpha is a 61 amino-acids peptide with 4 disulfide bridges, purified from Naja nigricollis snake venom.

We are the world exclusive source of this toxin.

Molecular formula: C₂₈₁H₄₅₇N₈₉O₉₁S₈
Amino-Acid sequence: LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Disulfide bridges : 3-23, 17-40, 42-53, 54-59
Primary structure: Click on the picture on the left.
Molecular weight : 6,795 Da
Purity : ≥ 95 % (HPLC); ≥ 98 % (Isoelectrofocusing) ; purification by double chromatography on ion exchange resin.

Biological Activity :

Short Neurotoxin alpha is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.

Its binding to acetylcholine receptor in vitro: 95-100 % (K_D ~ 2-7 10^-11 M).

Immunological characterization :
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +

Identification :

1. PRODUCT ID: L8101-Short Neurotoxin alpha
   
2. CAS Number : 54992-19-7
3. UNIPROT ID : P01426
4. PUBChem CID : 85470794
5. EC Number :
6. InChI Key: UIKYTGTVQPHGMS-RGTMCVMWSA-N
7. RTECS Number: XW5868100

Naja nigricollis Neurotoxin For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.