SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1

SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1

5.00 out of 5
(1 customer review)

$110.00$560.00

Name SHORT NEUROTOXIN alpha 
Molecular formula
Description It is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.


61-amino acid peptide with 4 disulfide bridges , from Naja nigricollis snake venom

Biological activity Its binding to acetylcholine receptor in vitro: 95-100 % (KD~ 2-7 10-11 M).

Immunological characterization:
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +1m2

Clear
Compare
SKU: N/A Category:

Description

BUY SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha; Short Neurotoxin 1

Short Neurotoxin alpha is a 61 amino-acids peptide with 4 disulfide bridges, purified from Naja nigricollis snake venom.

We are the world exclusive source of this toxin.

Molecular formula: C281H457N89O91S8
Amino-Acid sequence:
 LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Disulfide bridges : 3-23, 17-40, 42-53, 54-59
Primary structure: Click on the picture on the left.
Molecular weight : 6,795 Da
Purity : ≥ 95 % (HPLC); ≥ 98 % (Isoelectrofocusing) ; purification by double chromatography on ion exchange resin.


Biological Activity :

Short Neurotoxin alpha is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.

Its binding to acetylcholine receptor in vitro: 95-100 % (KD ~ 2-7 10-11 M).

Immunological characterization :
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +

Identification :

  1. PRODUCT ID: L8101-Short Neurotoxin alpha
  2. CAS Number : 54992-19-7
  3. UNIPROT ID : P01426
  4. PUBChem CID : 85470794
  5. EC Number :
  6. InChI Key: UIKYTGTVQPHGMS-RGTMCVMWSA-N
  7. RTECS Number: XW5868100

Naja nigricollis Neurotoxin For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

 

1 review for SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1

  1. 5 out of 5

    Klafero mac

    Thanks for fast shipping and our results wasgood

Add a review

Your email address will not be published. Required fields are marked *